SCOPe 2.06: Domain d2ppla2: 2ppl A:355-467

Lineage for d2ppla2 (2ppl A:355-467)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225245] (7 PDB entries)

8. Domain d2ppla2: 2ppl A:355-467 [205589]
   Other proteins in same PDB: d2ppla1, d2ppla3, d2ppla4
   automated match to d1rp1a1
   complexed with ca, na

Details for d2ppla2

PDB Entry: 2ppl, 2.2 Å

PDB Description: Human Pancreatic lipase-related protein 1

PDB Compounds: (A:) Pancreatic lipase-related protein 1

SCOPe Domain Sequences for d2ppla2:

Sequence; same for both SEQRES and ATOM records:

>d2ppla2 b.12.1.0 (A:355-467) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwrygvsitlsgrtatgqikvalfgnkgnthqysifrgilkpgsthsyefdakldvgtid
kvkflwnnnvinptlpkvgatkitvqkgeektvynfcsedtvredtlltltpc

Timeline for d2ppla2:

• d2ppla2 first appeared in SCOPe 2.03
  
• d2ppla2 appears in SCOPe 2.05
  
• d2ppla2 appears in SCOPe 2.07
  
• d2ppla2 appears in the current release, SCOPe 2.08