Lineage for d2ppla2 (2ppl A:355-467)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773710Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2773711Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2773794Family b.12.1.0: automated matches [227174] (1 protein)
    not a true family
  6. 2773795Protein automated matches [226891] (5 species)
    not a true protein
  7. 2773800Species Human (Homo sapiens) [TaxId:9606] [225245] (9 PDB entries)
  8. 2773803Domain d2ppla2: 2ppl A:355-467 [205589]
    Other proteins in same PDB: d2ppla1, d2ppla3, d2ppla4
    automated match to d1rp1a1
    complexed with ca, na

Details for d2ppla2

PDB Entry: 2ppl (more details), 2.2 Å

PDB Description: Human Pancreatic lipase-related protein 1
PDB Compounds: (A:) Pancreatic lipase-related protein 1

SCOPe Domain Sequences for d2ppla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppla2 b.12.1.0 (A:355-467) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwrygvsitlsgrtatgqikvalfgnkgnthqysifrgilkpgsthsyefdakldvgtid
kvkflwnnnvinptlpkvgatkitvqkgeektvynfcsedtvredtlltltpc

SCOPe Domain Coordinates for d2ppla2:

Click to download the PDB-style file with coordinates for d2ppla2.
(The format of our PDB-style files is described here.)

Timeline for d2ppla2: