Lineage for d2ppla1 (2ppl A:18-354)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135356Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 protein domains)
    automatically mapped to Pfam PF00151
  6. 2135374Protein automated matches [226890] (2 species)
    not a true protein
  7. 2135377Species Human (Homo sapiens) [TaxId:9606] [225244] (3 PDB entries)
  8. 2135378Domain d2ppla1: 2ppl A:18-354 [205588]
    Other proteins in same PDB: d2ppla2, d2ppla3, d2ppla4
    automated match to d1rp1a2
    complexed with ca, na

Details for d2ppla1

PDB Entry: 2ppl (more details), 2.2 Å

PDB Description: Human Pancreatic lipase-related protein 1
PDB Compounds: (A:) Pancreatic lipase-related protein 1

SCOPe Domain Sequences for d2ppla1:

Sequence, based on SEQRES records: (download)

>d2ppla1 c.69.1.19 (A:18-354) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevcyedlgcfsdtepwggtairplkilpwspekigtrfllytnenpnnfqilllsdpst
ieasnfqmdrktrfiihgfidkgdeswvtdmckklfeveevncicvdwkkgsqatytqaa
nnvrvvgaqvaqmldillteysyppskvhlighslgahvageagsktpglsritgldpve
asfestpeevrldpsdadfvdvihtdaaplipflgfgtnqqmghldffpnggesmpgckk
nalsqivdldgiwagtrdfvacnhlrsykyylesilnpdgfaaypctsyksfesdkcfpc
pdqgcpqmghyadkfagrtseeqqkfflntgeasnfa

Sequence, based on observed residues (ATOM records): (download)

>d2ppla1 c.69.1.19 (A:18-354) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevcyedlgcfsdtepwggtairplkilpwspekigtrfllytnenpnnfqilllsdpst
ieasnfqmdrktrfiihgfidkgdeswvtdmckklfeveevncicvdwkkgsqatytqaa
nnvrvvgaqvaqmldillteysyppskvhlighslgahvageagsktpglsritgldpve
asfestpeevrldpsdadfvdvihtdaaplipflgfgtnqqmghldffpnggesmpgckk
nalsqivdldgiwagtrdfvacnhlrsykyylesilnpdgfaaypctsyksfesdkcfpc
pdqgcpqmghyadkfagreqqkfflntgeasnfa

SCOPe Domain Coordinates for d2ppla1:

Click to download the PDB-style file with coordinates for d2ppla1.
(The format of our PDB-style files is described here.)

Timeline for d2ppla1: