Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Mesorhizobium loti [TaxId:266835] [225266] (1 PDB entry) |
Domain d2pozh1: 2poz H:4-118 [205585] Other proteins in same PDB: d2poza2, d2poza3, d2pozb2, d2pozb3, d2pozc2, d2pozc3, d2pozd2, d2pozd3, d2poze2, d2poze3, d2pozf2, d2pozf3, d2pozg2, d2pozg3, d2pozh2, d2pozh3 automated match to d2gl5a2 |
PDB Entry: 2poz (more details), 2.04 Å
SCOPe Domain Sequences for d2pozh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pozh1 d.54.1.0 (H:4-118) automated matches {Mesorhizobium loti [TaxId: 266835]} kitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfligk dpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfgg
Timeline for d2pozh1: