| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Mesorhizobium loti [TaxId:266835] [225266] (1 PDB entry) |
| Domain d2pozg1: 2poz G:3-118 [205583] Other proteins in same PDB: d2poza2, d2pozb2, d2pozc2, d2pozd2, d2poze2, d2pozf2, d2pozg2, d2pozh2 automated match to d2gl5a2 |
PDB Entry: 2poz (more details), 2.04 Å
SCOPe Domain Sequences for d2pozg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pozg1 d.54.1.0 (G:3-118) automated matches {Mesorhizobium loti [TaxId: 266835]}
lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfgg
Timeline for d2pozg1: