Lineage for d2poxd_ (2pox D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1408020Species Echinophyllia sp. [TaxId:301887] [188534] (12 PDB entries)
  8. 1408060Domain d2poxd_: 2pox D: [205570]
    automated match to d2pxwb_

Details for d2poxd_

PDB Entry: 2pox (more details), 1.95 Å

PDB Description: dark state structure of the reversibly switchable fluorescent protein dronpa
PDB Compounds: (D:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2poxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2poxd_ d.22.1.0 (D:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d2poxd_:

Click to download the PDB-style file with coordinates for d2poxd_.
(The format of our PDB-style files is described here.)

Timeline for d2poxd_: