SCOP 1.63: Domain d1lila1: 1lil A:2-107

Lineage for d1lila1 (1lil A:2-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Bence-Jones lambda L chain dimer CLE (human) [48926] (1 PDB entry)

8. Domain d1lila1: 1lil A:2-107 [20557]
   Other proteins in same PDB: d1lila2, d1lilb2

Details for d1lila1

PDB Entry: 1lil, 2.65 Å

PDB Description: bence jones protein cle, a lambda iii immunoglobulin light-chain dimer

SCOP Domain Sequences for d1lila1:

Sequence; same for both SEQRES and ATOM records:

>d1lila1 b.1.1.1 (A:2-107) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer CLE (human)}
yevtqppslsvspgqtaritcsgeklgdayvcwyqqrpgqspvvviyqdnrrpsgiperf
sgsssgntatltisgtqtldeadyycqvwdsnasvvfgggtkltvlg

Timeline for d1lila1:

• d1lila1 first appeared (with stable ids) in SCOP 1.55
  
• d1lila1 appears in SCOP 1.61
  
• d1lila1 appears in SCOP 1.65
  
• d1lila1 appears in the current release, SCOPe 2.08