Lineage for d2poxc_ (2pox C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1899479Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1899480Protein automated matches [190526] (20 species)
    not a true protein
  7. 1899550Species Echinophyllia sp. [TaxId:301887] [188534] (13 PDB entries)
  8. 1899589Domain d2poxc_: 2pox C: [205569]
    automated match to d2pxwb_

Details for d2poxc_

PDB Entry: 2pox (more details), 1.95 Å

PDB Description: Dark state structure of the reversibly switchable fluorescent protein Dronpa
PDB Compounds: (C:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2poxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2poxc_ d.22.1.0 (C:) automated matches {Echinophyllia sp. [TaxId: 301887]}
msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d2poxc_:

Click to download the PDB-style file with coordinates for d2poxc_.
(The format of our PDB-style files is described here.)

Timeline for d2poxc_: