Lineage for d2poxa1 (2pox A:1-218)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940840Domain d2poxa1: 2pox A:1-218 [205567]
    Other proteins in same PDB: d2poxa2, d2poxb2
    automated match to d2pxwb_

Details for d2poxa1

PDB Entry: 2pox (more details), 1.95 Å

PDB Description: dark state structure of the reversibly switchable fluorescent protein dronpa
PDB Compounds: (A:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2poxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2poxa1 d.22.1.0 (A:1-218) automated matches {Echinophyllia sp. [TaxId: 301887]}
msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d2poxa1:

Click to download the PDB-style file with coordinates for d2poxa1.
(The format of our PDB-style files is described here.)

Timeline for d2poxa1: