SCOPe 2.08: Domain d2poxa1: 2pox A:1-218

Lineage for d2poxa1 (2pox A:1-218)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)

8. Domain d2poxa1: 2pox A:1-218 [205567]
   Other proteins in same PDB: d2poxa2, d2poxb2
   automated match to d2pxwb_

Details for d2poxa1

PDB Entry: 2pox, 1.95 Å

PDB Description: dark state structure of the reversibly switchable fluorescent protein dronpa

PDB Compounds: (A:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2poxa1:

Sequence; same for both SEQRES and ATOM records:

>d2poxa1 d.22.1.0 (A:1-218) automated matches {Echinophyllia sp. [TaxId: 301887]}
msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

Timeline for d2poxa1:

• d2poxa1 first appeared in SCOPe 2.03, called d2poxa_
  
• d2poxa1 appears in SCOPe 2.07