| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
| Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
| Protein automated matches [226956] (4 species) not a true protein |
| Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries) |
| Domain d2po2a2: 2po2 A:154-244 [205566] Other proteins in same PDB: d2po2a1 automated match to d2nn6b2 complexed with cdp, mpd |
PDB Entry: 2po2 (more details), 2.41 Å
SCOPe Domain Sequences for d2po2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po2a2 d.101.1.0 (A:154-244) automated matches {Pyrococcus abyssi [TaxId: 29292]}
pmrdlvaacaagkiegeivldlnkeednygeadvpvaimplknditllqmdgyltkdefi
eavklaikgakavyqkqrealkekylkiaqe
Timeline for d2po2a2: