Lineage for d2po0a1 (2po0 A:9-153)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1402062Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1402063Protein automated matches [190826] (13 species)
    not a true protein
  7. 1402132Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)
  8. 1402135Domain d2po0a1: 2po0 A:9-153 [205561]
    Other proteins in same PDB: d2po0a2
    automated match to d2nn6b1
    complexed with adp, mpd

Details for d2po0a1

PDB Entry: 2po0 (more details), 2.3 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with ADP in double conformation
PDB Compounds: (A:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2po0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po0a1 d.14.1.0 (A:9-153) automated matches {Pyrococcus abyssi [TaxId: 29292]}
klidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygprelhpkhlq
rpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfprtaidvfie
vlqadagtrvagitaaslaladagi

SCOPe Domain Coordinates for d2po0a1:

Click to download the PDB-style file with coordinates for d2po0a1.
(The format of our PDB-style files is described here.)

Timeline for d2po0a1: