SCOP 1.73: Domain d2lvea_: 2lve A:

Lineage for d2lvea_ (2lve A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d2lvea_: 2lve A: [20556]
   VL dimer of Bence-Jones protein LEN

Details for d2lvea_

PDB Entry: 2lve, 2.7 Å

PDB Description: recombinant len

PDB Compounds: (A:) rlen

SCOP Domain Sequences for d2lvea_:

Sequence; same for both SEQRES and ATOM records:

>d2lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik

Timeline for d2lvea_:

• d2lvea_ first appeared (with stable ids) in SCOP 1.55, called d2lve__
  
• d2lvea_ was called d2lve__ in SCOP 1.71
  
• d2lvea_ appears in SCOP 1.75
  
• d2lvea_ appears in the current release, SCOPe 2.08