Lineage for d2lve__ (2lve -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries) 
Domain d2lve__: 2lve - [20556]
Details for d2lve__
PDB Entry: 2lve (more details), 2.7 Å
PDB Description: recombinant len
SCOP Domain Sequences for d2lve__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lve__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik
SCOP Domain Coordinates for d2lve__:
Click to download the PDB-style file with coordinates for d2lve__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lve__:
- d2lve__ appears in SCOP 1.57
- d2lve__ appears in the current release, SCOPe 2.08, called d2lvea_
View in 3D