Lineage for d2pnza1 (2pnz A:9-153)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177072Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2177073Protein automated matches [190826] (17 species)
    not a true protein
  7. 2177178Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)
  8. 2177181Domain d2pnza1: 2pnz A:9-153 [205559]
    Other proteins in same PDB: d2pnza2, d2pnzb2
    automated match to d2nn6b1
    complexed with 5gp, mpd, udp

Details for d2pnza1

PDB Entry: 2pnz (more details), 2.14 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with UDP and GMP
PDB Compounds: (A:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2pnza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnza1 d.14.1.0 (A:9-153) automated matches {Pyrococcus abyssi [TaxId: 29292]}
klidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygprelhpkhlq
rpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfprtaidvfie
vlqadagtrvagitaaslaladagi

SCOPe Domain Coordinates for d2pnza1:

Click to download the PDB-style file with coordinates for d2pnza1.
(The format of our PDB-style files is described here.)

Timeline for d2pnza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pnza2