Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries) |
Domain d2pn8j1: 2pn8 J:84-269 [205558] Other proteins in same PDB: d2pn8a2, d2pn8b2, d2pn8c2, d2pn8d2, d2pn8e2, d2pn8f2, d2pn8g2, d2pn8h2, d2pn8i2, d2pn8j2 automated match to d1uula_ |
PDB Entry: 2pn8 (more details), 1.8 Å
SCOPe Domain Sequences for d2pn8j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pn8j1 c.47.1.0 (J:84-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} papywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsint evvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglf iiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagk lkyfdk
Timeline for d2pn8j1: