SCOPe 2.07: Domain d2pn8f1: 2pn8 F:84-269

Lineage for d2pn8f1 (2pn8 F:84-269)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2pn8f1: 2pn8 F:84-269 [205554]
   Other proteins in same PDB: d2pn8a2, d2pn8b2, d2pn8c2, d2pn8d2, d2pn8e2, d2pn8f2, d2pn8g2, d2pn8h2, d2pn8i2, d2pn8j2
   automated match to d1uula_

Details for d2pn8f1

PDB Entry: 2pn8, 1.8 Å

PDB Description: Crystal structure of human peroxiredoxin 4 (thioredoxin peroxidase)

PDB Compounds: (F:) Peroxiredoxin-4

SCOPe Domain Sequences for d2pn8f1:

Sequence; same for both SEQRES and ATOM records:

>d2pn8f1 c.47.1.0 (F:84-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
papywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsint
evvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglf
iiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagk
lkyfdk

Timeline for d2pn8f1:

• d2pn8f1 first appeared in SCOPe 2.03, called d2pn8f_
  
• d2pn8f1 appears in SCOPe 2.06
  
• d2pn8f1 appears in the current release, SCOPe 2.08