Lineage for d2pn8c1 (2pn8 C:84-269)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879639Domain d2pn8c1: 2pn8 C:84-269 [205551]
    Other proteins in same PDB: d2pn8a2, d2pn8b2, d2pn8c2, d2pn8d2, d2pn8e2, d2pn8f2, d2pn8g2, d2pn8h2, d2pn8i2, d2pn8j2
    automated match to d1uula_

Details for d2pn8c1

PDB Entry: 2pn8 (more details), 1.8 Å

PDB Description: Crystal structure of human peroxiredoxin 4 (thioredoxin peroxidase)
PDB Compounds: (C:) Peroxiredoxin-4

SCOPe Domain Sequences for d2pn8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pn8c1 c.47.1.0 (C:84-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
papywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsint
evvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglf
iiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagk
lkyfdk

SCOPe Domain Coordinates for d2pn8c1:

Click to download the PDB-style file with coordinates for d2pn8c1.
(The format of our PDB-style files is described here.)

Timeline for d2pn8c1: