Lineage for d2pmua_ (2pmu A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260359Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1260445Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1260446Protein automated matches [190858] (9 species)
    not a true protein
  7. 1260466Species Mycobacterium tuberculosis [TaxId:83332] [225356] (2 PDB entries)
  8. 1260467Domain d2pmua_: 2pmu A: [205543]
    automated match to d1gxpb_
    complexed with cl, gly, k, po4, unx

Details for d2pmua_

PDB Entry: 2pmu (more details), 1.78 Å

PDB Description: crystal structure of the dna-binding domain of phop
PDB Compounds: (A:) response regulator PHOP

SCOPe Domain Sequences for d2pmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmua_ a.4.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwrydfg
gdvnvvesyvsylrrkidtgekrllhtlrgvgyvlrep

SCOPe Domain Coordinates for d2pmua_:

Click to download the PDB-style file with coordinates for d2pmua_.
(The format of our PDB-style files is described here.)

Timeline for d2pmua_: