Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (40 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [193352] (6 PDB entries) |
Domain d2pkna_: 2pkn A: [205540] automated match to d2pkma_ complexed with acp |
PDB Entry: 2pkn (more details), 1.9 Å
SCOPe Domain Sequences for d2pkna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkna_ c.72.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrggvagnmafaigvl ggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypga msearnikladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsge eirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgttih vgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwdy eaaasrlagaygehaaaeivavl
Timeline for d2pkna_: