SCOPe 2.08: Domain d2pkfb1: 2pkf B:0-324

Lineage for d2pkfb1 (2pkf B:0-324)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [193352] (12 PDB entries)

8. Domain d2pkfb1: 2pkf B:0-324 [205538]
   Other proteins in same PDB: d2pkfa2, d2pkfb2
   automated match to d2pkma_

Details for d2pkfb1

PDB Entry: 2pkf, 1.5 Å

PDB Description: Crystal structure of M tuberculosis Adenosine Kinase (apo)

PDB Compounds: (B:) adenosine kinase

SCOPe Domain Sequences for d2pkfb1:

Sequence; same for both SEQRES and ATOM records:

>d2pkfb1 c.72.1.0 (B:0-324) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hmtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrggvagnmafaigv
lggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypg
amsearnikladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsg
eeirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgtti
hvgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwd
yeaaasrlagaygehaaaeivavla

Timeline for d2pkfb1:

• d2pkfb1 first appeared in SCOPe 2.03, called d2pkfb_
  
• d2pkfb1 appears in SCOPe 2.07