![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [193352] (12 PDB entries) |
![]() | Domain d2pkfb1: 2pkf B:0-324 [205538] Other proteins in same PDB: d2pkfa2, d2pkfb2 automated match to d2pkma_ |
PDB Entry: 2pkf (more details), 1.5 Å
SCOPe Domain Sequences for d2pkfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkfb1 c.72.1.0 (B:0-324) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} hmtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrggvagnmafaigv lggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypg amsearnikladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsg eeirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgtti hvgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwd yeaaasrlagaygehaaaeivavla
Timeline for d2pkfb1: