SCOPe 2.06: Domain d2pk3a_: 2pk3 A:

Lineage for d2pk3a_ (2pk3 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Aneurinibacillus thermoaerophilus [TaxId:143495] [225432] (1 PDB entry)

8. Domain d2pk3a_: 2pk3 A: [205535]
   automated match to d1r66a_
   complexed with a2r, gdd

Details for d2pk3a_

PDB Entry: 2pk3, 1.82 Å

PDB Description: Crystal Structure of a GDP-4-keto-6-deoxy-D-mannose reductase

PDB Compounds: (A:) GDP-6-deoxy-D-lyxo-4-hexulose reductase

SCOPe Domain Sequences for d2pk3a_:

Sequence; same for both SEQRES and ATOM records:

>d2pk3a_ c.2.1.0 (A:) automated matches {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mralitgvagfvgkylanhlteqnvevfgtsrnneaklpnvemisldimdsqrvkkvisd
ikpdyifhlaakssvkdswlnkkgtfstnvfgtlhvldavrdsnldcriltigsseeygm
ilpeespvseenqlrpmspygvskasvgmlarqyvkaygmdiihtrtfnhigpgqslgfv
tqdfakqivdiemekqepiikvgnleavrdftdvrdivqaywllsqygktgdvynvcsgi
gtriqdvldlllamanvkidtelnplqlrpsevptligsnkrlkdstgwkpriplekslf
eilqsyrqa

Timeline for d2pk3a_:

• d2pk3a_ first appeared in SCOPe 2.03
  
• d2pk3a_ appears in SCOPe 2.05
  
• d2pk3a_ appears in SCOPe 2.07
  
• d2pk3a_ appears in the current release, SCOPe 2.08