SCOPe 2.08: Domain d3lvea_: 3lve A:

Lineage for d3lvea_ (3lve A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d3lvea_: 3lve A: [20552]
   VL dimer of Bence-Jones protein LEN
   complexed with zn; mutant

Details for d3lvea_

PDB Entry: 3lve, 2 Å

PDB Description: len q38e mutant: a domain flip from a single amino acid substitution

PDB Compounds: (A:) len

SCOPe Domain Sequences for d3lvea_:

Sequence; same for both SEQRES and ATOM records:

>d3lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

Timeline for d3lvea_:

• d3lvea_ first appeared (with stable ids) in SCOP 1.55, called d3lve__
  
• d3lvea_ appears in SCOPe 2.07