SCOPe 2.08: Domain d2pezb_: 2pez B:

Lineage for d2pezb_ (2pez B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein automated matches [226942] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225272] (2 PDB entries)

8. Domain d2pezb_: 2pez B: [205518]
   automated match to d1m7gd_
   complexed with dat, ggz; mutant

Details for d2pezb_

PDB Entry: 2pez, 1.4 Å

PDB Description: Crystal structrue of deletion mutant of APS-kinase domain of human PAPS-synthetase 1 in complex with cyclic PAPS and dADP

PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)

SCOPe Domain Sequences for d2pezb_:

Sequence, based on SEQRES records:

>d2pezb_ c.37.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvr
riaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvk
glykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv

Sequence, based on observed residues (ATOM records):

>d2pezb_ c.37.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvr
riaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvk
glyeyekpeapelvlktdscdvndcvqqvvellqerdiv

Timeline for d2pezb_:

• d2pezb_ first appeared in SCOPe 2.03
  
• d2pezb_ appears in SCOPe 2.07