Lineage for d2peyb_ (2pey B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866412Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2866432Protein automated matches [226942] (4 species)
    not a true protein
  7. 2866449Species Human (Homo sapiens) [TaxId:9606] [225272] (2 PDB entries)
  8. 2866453Domain d2peyb_: 2pey B: [205516]
    automated match to d1m7gd_
    complexed with adx, dat; mutant

Details for d2peyb_

PDB Entry: 2pey (more details), 1.88 Å

PDB Description: crystal structure of deletion mutant of aps-kinase domain of human paps-synthetase 1
PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)

SCOPe Domain Sequences for d2peyb_:

Sequence, based on SEQRES records: (download)

>d2peyb_ c.37.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenv
rriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdv
kglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv

Sequence, based on observed residues (ATOM records): (download)

>d2peyb_ c.37.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenv
rriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdv
eyekpeapelvlktdscdvndcvqqvvellqerdiv

SCOPe Domain Coordinates for d2peyb_:

Click to download the PDB-style file with coordinates for d2peyb_.
(The format of our PDB-style files is described here.)

Timeline for d2peyb_: