SCOPe 2.07: Domain d2peya_: 2pey A:

Lineage for d2peya_ (2pey A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein automated matches [226942] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225272] (2 PDB entries)

8. Domain d2peya_: 2pey A: [205515]
   automated match to d1m7gd_
   complexed with adx, dat; mutant

Details for d2peya_

PDB Entry: 2pey, 1.88 Å

PDB Description: crystal structure of deletion mutant of aps-kinase domain of human paps-synthetase 1

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)

SCOPe Domain Sequences for d2peya_:

Sequence; same for both SEQRES and ATOM records:

>d2peya_ c.37.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenv
rriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdv
kglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv

Timeline for d2peya_:

• d2peya_ first appeared in SCOPe 2.03
  
• d2peya_ appears in SCOPe 2.06
  
• d2peya_ appears in the current release, SCOPe 2.08