SCOPe 2.08: Domain d2pera2: 2per A:98-246

Lineage for d2pera2 (2per A:98-246)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)

8. Domain d2pera2: 2per A:98-246 [205514]
   Other proteins in same PDB: d2pera1
   automated match to d1k0ma1
   complexed with mnb

Details for d2pera2

PDB Entry: 2per, 2 Å

PDB Description: crystal structure of human chloride intracellular channel protein 2

PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d2pera2:

Sequence; same for both SEQRES and ATOM records:

>d2pera2 a.45.1.0 (A:98-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ryphlspkykesfdvgcnlfakfsayikntqkeanknfeksllkefkrlddylntpllde
idpdsaeeppvsrrlfldgdqltladcsllpklniikvaakkyrdfdipaefsgvwrylh
nayareefthtcpedkeientyanvakqk

Timeline for d2pera2:

• d2pera2 first appeared in SCOPe 2.03
  
• d2pera2 appears in SCOPe 2.07