![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries) |
![]() | Domain d2pera2: 2per A:98-246 [205514] Other proteins in same PDB: d2pera1 automated match to d1k0ma1 complexed with mnb |
PDB Entry: 2per (more details), 2 Å
SCOPe Domain Sequences for d2pera2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pera2 a.45.1.0 (A:98-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} ryphlspkykesfdvgcnlfakfsayikntqkeanknfeksllkefkrlddylntpllde idpdsaeeppvsrrlfldgdqltladcsllpklniikvaakkyrdfdipaefsgvwrylh nayareefthtcpedkeientyanvakqk
Timeline for d2pera2: