Lineage for d2pera1 (2per A:11-97)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879799Domain d2pera1: 2per A:11-97 [205513]
    Other proteins in same PDB: d2pera2
    automated match to d1k0ma2
    complexed with mnb

Details for d2pera1

PDB Entry: 2per (more details), 2 Å

PDB Description: crystal structure of human chloride intracellular channel protein 2
PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d2pera1:

Sequence, based on SEQRES records: (download)

>d2pera1 c.47.1.0 (A:11-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmtrkpeelkdlapgtnp
pflvynkelktdfikieefleqtlapp

Sequence, based on observed residues (ATOM records): (download)

>d2pera1 c.47.1.0 (A:11-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmnppflvynkelktdfi
kieefleqtlapp

SCOPe Domain Coordinates for d2pera1:

Click to download the PDB-style file with coordinates for d2pera1.
(The format of our PDB-style files is described here.)

Timeline for d2pera1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pera2