SCOPe 2.05: Domain d2pceh1: 2pce H:1-127

Lineage for d2pceh1 (2pce H:1-127)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)

8. Domain d2pceh1: 2pce H:1-127 [205509]
   Other proteins in same PDB: d2pcea2, d2pceb2, d2pcec2, d2pced2, d2pcee2, d2pcef2, d2pceg2, d2pceh2
   automated match to d1jpma2
   complexed with po4

Details for d2pceh1

PDB Entry: 2pce, 2 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism

PDB Compounds: (H:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pceh1:

Sequence; same for both SEQRES and ATOM records:

>d2pceh1 d.54.1.0 (H:1-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
lcdmtgg

Timeline for d2pceh1:

• d2pceh1 first appeared in SCOPe 2.03
  
• d2pceh1 appears in SCOPe 2.04
  
• d2pceh1 appears in SCOPe 2.06
  
• d2pceh1 appears in the current release, SCOPe 2.08