Lineage for d2pceh1 (2pce H:2-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948495Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 2948511Domain d2pceh1: 2pce H:2-127 [205509]
    Other proteins in same PDB: d2pcea2, d2pcea3, d2pceb2, d2pceb3, d2pcec2, d2pcec3, d2pced2, d2pced3, d2pcee2, d2pcee3, d2pcef2, d2pcef3, d2pceg2, d2pceg3, d2pceh2, d2pceh3
    automated match to d1jpma2
    complexed with po4

Details for d2pceh1

PDB Entry: 2pce (more details), 2 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (H:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pceh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pceh1 d.54.1.0 (H:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
kitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaah
aggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglpl
cdmtgg

SCOPe Domain Coordinates for d2pceh1:

Click to download the PDB-style file with coordinates for d2pceh1.
(The format of our PDB-style files is described here.)

Timeline for d2pceh1: