SCOPe 2.08: Domain d2pcea1: 2pce A:2-127

Lineage for d2pcea1 (2pce A:2-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)

8. Domain d2pcea1: 2pce A:2-127 [205495]
   Other proteins in same PDB: d2pcea2, d2pcea3, d2pceb2, d2pceb3, d2pcec2, d2pcec3, d2pced2, d2pced3, d2pcee2, d2pcee3, d2pcef2, d2pcef3, d2pceg2, d2pceg3, d2pceh2, d2pceh3
   automated match to d1jpma2
   complexed with po4

Details for d2pcea1

PDB Entry: 2pce, 2 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism

PDB Compounds: (A:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pcea1:

Sequence; same for both SEQRES and ATOM records:

>d2pcea1 d.54.1.0 (A:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
kitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaah
aggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglpl
cdmtgg

Timeline for d2pcea1:

• d2pcea1 first appeared in SCOPe 2.03
  
• d2pcea1 appears in SCOPe 2.07