Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Norway rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (5 PDB entries) Uniprot P22756 429-546,667-799! Uniprot P22756 433-544,682-815 |
Domain d2pbwa1: 2pbw A:4-118,A:119-251 [205489] Other proteins in same PDB: d2pbwb_ automated match to d1ycja1 complexed with doq |
PDB Entry: 2pbw (more details), 2.5 Å
SCOPe Domain Sequences for d2pbwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbwa1 c.94.1.1 (A:4-118,A:119-251) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR5 [TaxId: 10116]} rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtXpids addlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlt tdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegk lhmmkekww
Timeline for d2pbwa1: