Lineage for d2pbpa_ (2pbp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853740Species Geobacillus kaustophilus [TaxId:235909] [193499] (3 PDB entries)
  8. 2853750Domain d2pbpa_: 2pbp A: [205488]
    automated match to d3moya_

Details for d2pbpa_

PDB Entry: 2pbp (more details), 1.8 Å

PDB Description: crystal structure of enoyl-coa hydrates subunit i (gk_2039) from geobacillus kaustophilus hta426
PDB Compounds: (A:) Enoyl-CoA hydratase subunit I

SCOPe Domain Sequences for d2pbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbpa_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
fvsiaarqegavgiielarpdvlnalsrqmvaeivaaveafdrnekvrvivltgrgrafa
agadiqemakddpirlewlnqfadwdrlsivktpmiaavnglalgggfelalscdlivas
saaefgfpevnlgvmpgaggtqrltkligpkralewlwtgarmsakeaeqlgivnrvvsp
ellmeetmrlagrlaeqpplalrlikeavqkavdyplyegmqferknfyllfasedqkeg
maaflekrkprfqgk

SCOPe Domain Coordinates for d2pbpa_:

Click to download the PDB-style file with coordinates for d2pbpa_.
(The format of our PDB-style files is described here.)

Timeline for d2pbpa_: