Lineage for d2pa6a2 (2pa6 A:147-427)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343756Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1343757Protein Enolase [51606] (9 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1343820Species Methanocaldococcus jannaschii [TaxId:2190] [225343] (1 PDB entry)
  8. 1343821Domain d2pa6a2: 2pa6 A:147-427 [205484]
    Other proteins in same PDB: d2pa6a1, d2pa6b1
    automated match to d1pdza1

Details for d2pa6a2

PDB Entry: 2pa6 (more details), 1.85 Å

PDB Description: Crystal structure of MJ0232 from Methanococcus jannaschii
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d2pa6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pa6a2 c.1.11.1 (A:147-427) Enolase {Methanocaldococcus jannaschii [TaxId: 2190]}
vmpvpmmnvinggkhagndldlqefmimpvgatsiseavrmgsevyhvlknvilekygkn
avnvgdeggfapplktsrealdlltesvkkagyedevvfaldaaasefykdgyyyvegkk
ltreelldyykalvdeypivsiedpfheedfegfamitkeldiqivgddlfvtnverlrk
giemkaanalllkvnqigtlseavdaaqlafrngygvvvshrsgetedttiadlsvalns
gqiktgapargertakynqlirieqelglskyagrnfrcpf

SCOPe Domain Coordinates for d2pa6a2:

Click to download the PDB-style file with coordinates for d2pa6a2.
(The format of our PDB-style files is described here.)

Timeline for d2pa6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pa6a1