Lineage for d2p8va_ (2p8v A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394770Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 protein domains)
  6. 2394806Protein automated matches [226957] (1 species)
    not a true protein
  7. 2394807Species Human (Homo sapiens) [TaxId:9606] [225382] (9 PDB entries)
  8. 2394815Domain d2p8va_: 2p8v A: [205482]
    automated match to d1i7aa_
    complexed with so4

Details for d2p8va_

PDB Entry: 2p8v (more details), 1.85 Å

PDB Description: crystal structure of human homer3 evh1 domain
PDB Compounds: (A:) Homer protein homolog 3

SCOPe Domain Sequences for d2p8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8va_ b.55.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stareqpifstrahvfqidpatkrnwipagkhaltvsyfydatrnvyriisiggakaiin
stvtpnmtftktsqkfgqwadsrantvyglgfaseqhltqfaekfqevkeaarlare

SCOPe Domain Coordinates for d2p8va_:

Click to download the PDB-style file with coordinates for d2p8va_.
(The format of our PDB-style files is described here.)

Timeline for d2p8va_: