Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [225290] (3 PDB entries) |
Domain d2p8ca2: 2p8c A:126-369 [205480] Other proteins in same PDB: d2p8ca1 automated match to d1nu5a1 complexed with mg, sug |
PDB Entry: 2p8c (more details), 2 Å
SCOPe Domain Sequences for d2p8ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8ca2 c.1.11.0 (A:126-369) automated matches {Bacillus cereus [TaxId: 226900]} ryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavrervgnd iairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlplmideg lkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvessvassa gfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqeltvfq divr
Timeline for d2p8ca2: