Lineage for d2p8ca1 (2p8c A:1-125)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413033Species Bacillus cereus [TaxId:226900] [225289] (3 PDB entries)
  8. 1413035Domain d2p8ca1: 2p8c A:1-125 [205479]
    Other proteins in same PDB: d2p8ca2
    automated match to d1nu5a2
    complexed with mg, sug

Details for d2p8ca1

PDB Entry: 2p8c (more details), 2 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579 complexed with N-succinyl Arg.
PDB Compounds: (A:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8ca1 d.54.1.0 (A:1-125) automated matches {Bacillus cereus [TaxId: 226900]}
mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
qligg

SCOPe Domain Coordinates for d2p8ca1:

Click to download the PDB-style file with coordinates for d2p8ca1.
(The format of our PDB-style files is described here.)

Timeline for d2p8ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p8ca2