SCOPe 2.04: Domain d2p8ba2: 2p8b A:126-369

Lineage for d2p8ba2 (2p8b A:126-369)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [225290] (3 PDB entries)

8. Domain d2p8ba2: 2p8b A:126-369 [205478]
   Other proteins in same PDB: d2p8ba1
   automated match to d1nu5a1
   complexed with mg, nsk

Details for d2p8ba2

PDB Entry: 2p8b, 1.7 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579 complexed with N-succinyl Lys.

PDB Compounds: (A:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p8ba2:

Sequence; same for both SEQRES and ATOM records:

>d2p8ba2 c.1.11.0 (A:126-369) automated matches {Bacillus cereus [TaxId: 226900]}
ryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavrervgnd
iairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlplmideg
lkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvessvassa
gfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqeltvfq
divr

Timeline for d2p8ba2:

• d2p8ba2 first appeared in SCOPe 2.03
  
• d2p8ba2 appears in SCOPe 2.05
  
• d2p8ba2 appears in the current release, SCOPe 2.08