| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Bacillus cereus [TaxId:226900] [225289] (3 PDB entries) |
| Domain d2p8ba1: 2p8b A:1-125 [205477] Other proteins in same PDB: d2p8ba2 automated match to d1nu5a2 complexed with mg, nsk |
PDB Entry: 2p8b (more details), 1.7 Å
SCOPe Domain Sequences for d2p8ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8ba1 d.54.1.0 (A:1-125) automated matches {Bacillus cereus [TaxId: 226900]}
mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
qligg
Timeline for d2p8ba1: