SCOPe 2.08: Domain d2p88g1: 2p88 G:1-125

Lineage for d2p88g1 (2p88 G:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [225289] (3 PDB entries)

8. Domain d2p88g1: 2p88 G:1-125 [205473]
   Other proteins in same PDB: d2p88a2, d2p88b2, d2p88c2, d2p88d2, d2p88e2, d2p88f2, d2p88g2, d2p88h2
   automated match to d1nu5a2
   complexed with mg

Details for d2p88g1

PDB Entry: 2p88, 2.4 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579

PDB Compounds: (G:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p88g1:

Sequence; same for both SEQRES and ATOM records:

>d2p88g1 d.54.1.0 (G:1-125) automated matches {Bacillus cereus [TaxId: 226900]}
mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
qligg

Timeline for d2p88g1:

• d2p88g1 first appeared in SCOPe 2.03
  
• d2p88g1 appears in SCOPe 2.07