Lineage for d1eeub_ (1eeu B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219259Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)
  8. 219263Domain d1eeub_: 1eeu B: [20547]
    complexed with ipa; mutant

Details for d1eeub_

PDB Entry: 1eeu (more details), 1.6 Å

PDB Description: m4l/y(27d)d/q89d/t94h mutant of len

SCOP Domain Sequences for d1eeub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeub_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleik

SCOP Domain Coordinates for d1eeub_:

Click to download the PDB-style file with coordinates for d1eeub_.
(The format of our PDB-style files is described here.)

Timeline for d1eeub_: