![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [225289] (3 PDB entries) |
![]() | Domain d2p88d1: 2p88 D:1-125 [205467] Other proteins in same PDB: d2p88a2, d2p88b2, d2p88c2, d2p88d2, d2p88e2, d2p88f2, d2p88g2, d2p88h2 automated match to d1nu5a2 complexed with mg |
PDB Entry: 2p88 (more details), 2.4 Å
SCOPe Domain Sequences for d2p88d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p88d1 d.54.1.0 (D:1-125) automated matches {Bacillus cereus [TaxId: 226900]} mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy qligg
Timeline for d2p88d1: