Lineage for d2p85c_ (2p85 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278021Species Human (Homo sapiens) [TaxId:9606] [196470] (23 PDB entries)
  8. 1278085Domain d2p85c_: 2p85 C: [205457]
    automated match to d1dt6a_
    complexed with hem, ind

Details for d2p85c_

PDB Entry: 2p85 (more details), 2.35 Å

PDB Description: Structure of Human Lung Cytochrome P450 2A13 with indole bound in two alternate conformations
PDB Compounds: (C:) Cytochrome P450 2A13

SCOPe Domain Sequences for d2p85c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p85c_ a.104.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d2p85c_:

Click to download the PDB-style file with coordinates for d2p85c_.
(The format of our PDB-style files is described here.)

Timeline for d2p85c_: