![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
![]() | Domain d2p85b_: 2p85 B: [205456] automated match to d1dt6a_ complexed with hem, ind |
PDB Entry: 2p85 (more details), 2.35 Å
SCOPe Domain Sequences for d2p85b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p85b_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr
Timeline for d2p85b_: