Lineage for d2p7za_ (2p7z A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335473Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 2335474Species Human (Homo sapiens) [TaxId:9606] [81917] (14 PDB entries)
    Uniprot O75454 233-458
  8. 2335488Domain d2p7za_: 2p7z A: [205454]
    automated match to d1tfca_
    complexed with oht

Details for d2p7za_

PDB Entry: 2p7z (more details), 2.5 Å

PDB Description: Estrogen Related Receptor Gamma in complex with 4-hydroxy-tamoxifen
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d2p7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7za_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfynikle

SCOPe Domain Coordinates for d2p7za_:

Click to download the PDB-style file with coordinates for d2p7za_.
(The format of our PDB-style files is described here.)

Timeline for d2p7za_: