SCOPe 2.06: Domain d2p6xb_: 2p6x B:

Lineage for d2p6xb_ (2p6x B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (117 PDB entries)

8. Domain d2p6xb_: 2p6x B: [205453]
   Other proteins in same PDB: d2p6xa2
   automated match to d2h04a_
   complexed with cl, edo

Details for d2p6xb_

PDB Entry: 2p6x, 1.9 Å

PDB Description: crystal structure of human tyrosine phosphatase ptpn22

PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 22

SCOPe Domain Sequences for d2p6xb_:

Sequence; same for both SEQRES and ATOM records:

>d2p6xb_ c.45.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qreilqkfldeaqskkitkeefaneflklkrqstkykadktypttvaekpknikknrykd
ilpydysrvelslitsdedssyinanfikgvygpkayiatqgplsttlldfwrmiweysv
liivmacmeyemgkkkcerywaepgemqlefgpfsvsceaekrksdyiirtlkvkfnset
rtiyqfhyknwpdhdvpssidpileliwdvrcyqeddsvpicihcsagcgrtgvicaidy
twmllkdgiipenfsvfsliremrtqrpslvqtqeqyelvynavlelfkrqmdvir

Timeline for d2p6xb_:

• d2p6xb_ first appeared in SCOPe 2.03
  
• d2p6xb_ appears in SCOPe 2.05
  
• d2p6xb_ appears in SCOPe 2.07
  
• d2p6xb_ appears in the current release, SCOPe 2.08