SCOPe 2.06: Domain d2p5sb_: 2p5s B:

Lineage for d2p5sb_ (2p5s B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d2p5sb_: 2p5s B: [205452]
   automated match to d3sfva_
   complexed with gdp, unx

Details for d2p5sb_

PDB Entry: 2p5s, 2.15 Å

PDB Description: rab domain of human rasef in complex with gdp

PDB Compounds: (B:) RAS and EF-hand domain containing

SCOPe Domain Sequences for d2p5sb_:

Sequence, based on SEQRES records:

>d2p5sb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aykivlagdaavgkssflmrlcknefrenisatlgvdfqmktlivdgertvlqlwdtagq
erfrsiaksyfrkadgvlllydvtceksflnirewvdmiedaahetvpimlvgnkadird
taategqkcvpghfgeklamtygalfcetsakdgsniveavlhlarevkkr

Sequence, based on observed residues (ATOM records):

>d2p5sb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aykivlagdaavgkssflmrlcknefrgvdfqmktlivdgertvlqlwdtagqerfrsia
ksyfrkadgvlllydvtceksflnirewvdmiedaavpimlvgnkadirdtaategqkcv
pghfgeklamtygalfcetsakdgsniveavlhlarevkkr

Timeline for d2p5sb_:

• d2p5sb_ first appeared in SCOPe 2.03
  
• d2p5sb_ appears in SCOPe 2.05
  
• d2p5sb_ appears in SCOPe 2.07
  
• d2p5sb_ appears in the current release, SCOPe 2.08