SCOP 1.61: Domain d1eeqb_: 1eeq B:

Lineage for d1eeqb_ (1eeq B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)

8. Domain d1eeqb_: 1eeq B: [20545]

Details for d1eeqb_

PDB Entry: 1eeq, 1.5 Å

PDB Description: m4l/y(27d)d/t94h mutant of len

SCOP Domain Sequences for d1eeqb_:

Sequence; same for both SEQRES and ATOM records:

>d1eeqb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik

Timeline for d1eeqb_:

• d1eeqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eeqb_ appears in SCOP 1.59
  
• d1eeqb_ appears in SCOP 1.63
  
• d1eeqb_ appears in the current release, SCOPe 2.08