![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families) ![]() automatically mapped to Pfam PF03449 |
![]() | Family a.2.1.0: automated matches [227221] (1 protein) not a true family |
![]() | Protein automated matches [226962] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [225398] (1 PDB entry) |
![]() | Domain d2p4ve1: 2p4v E:1-79 [205447] Other proteins in same PDB: d2p4va2, d2p4vb2, d2p4vc2, d2p4vd2, d2p4ve2, d2p4vf2 automated match to d1grja1 |
PDB Entry: 2p4v (more details), 2.6 Å
SCOPe Domain Sequences for d2p4ve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4ve1 a.2.1.0 (E:1-79) automated matches {Escherichia coli [TaxId: 562]} mktplvtregyeklkqelnylwreerpevtkkvtwaaslgdrsenadyqynkkrlreidr rvryltkcmenlkivdysp
Timeline for d2p4ve1: