SCOP 1.71: Domain d1eeqa_: 1eeq A:

Lineage for d1eeqa_ (1eeq A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d1eeqa_: 1eeq A: [20544]

Details for d1eeqa_

PDB Entry: 1eeq, 1.5 Å

PDB Description: m4l/y(27d)d/t94h mutant of len

SCOP Domain Sequences for d1eeqa_:

Sequence; same for both SEQRES and ATOM records:

>d1eeqa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik

Timeline for d1eeqa_:

• d1eeqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1eeqa_ appears in SCOP 1.69
  
• d1eeqa_ appears in SCOP 1.73
  
• d1eeqa_ appears in the current release, SCOPe 2.08