Lineage for d2p4va1 (2p4v A:1-79)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689746Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families) (S)
    automatically mapped to Pfam PF03449
  5. 2689762Family a.2.1.0: automated matches [227221] (1 protein)
    not a true family
  6. 2689763Protein automated matches [226962] (1 species)
    not a true protein
  7. 2689764Species Escherichia coli [TaxId:562] [225398] (1 PDB entry)
  8. 2689765Domain d2p4va1: 2p4v A:1-79 [205439]
    Other proteins in same PDB: d2p4va2, d2p4vb2, d2p4vc2, d2p4vd2, d2p4ve2, d2p4vf2
    automated match to d1grja1

Details for d2p4va1

PDB Entry: 2p4v (more details), 2.6 Å

PDB Description: Crystal structure of the transcript cleavage factor, GreB at 2.6A resolution
PDB Compounds: (A:) Transcription elongation factor greB

SCOPe Domain Sequences for d2p4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4va1 a.2.1.0 (A:1-79) automated matches {Escherichia coli [TaxId: 562]}
mktplvtregyeklkqelnylwreerpevtkkvtwaaslgdrsenadyqynkkrlreidr
rvryltkcmenlkivdysp

SCOPe Domain Coordinates for d2p4va1:

Click to download the PDB-style file with coordinates for d2p4va1.
(The format of our PDB-style files is described here.)

Timeline for d2p4va1: